This is a working overview of secondary drying, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-01-24. Anything still debated is marked as such rather than presented as settled.
Storage stability depends on water content, oxygen exposure, and temperature. Lyophilized solids are hygroscopic and can absorb water if exposed to humid air. Vials are usually sealed under vacuum or inert gas with rubber stoppers and aluminum crimps. Storage temperatures range from room temperature to refrigerated or frozen conditions depending on the material. Stability studies track potency, moisture, and physical form over time. Accelerated conditions can reveal sensitivity but may not predict long-term behavior.
Analytical methods for lyophilized materials include X-ray diffraction for crystallinity, differential scanning calorimetry for thermal transitions, and scanning electron microscopy for pore morphology. Moisture sorption analysis shows how the cake responds to humidity. These methods help distinguish amorphous from crystalline states and detect phase changes. Open questions remain about how pore structure changes during long-term storage and how best to predict collapse under varied conditions. Comparisons across studies are complicated by differences in formulation, cycle, and storage history.
Quality control for lyophilized products focuses on appearance, moisture level, reconstitution time, and structural integrity. A cake should be uniform, intact, and free of meltback or collapse. Moisture level is measured by Karl Fischer titration or thermogravimetric analysis. Reconstitution time reflects pore structure and formulation. Visual inspection and vial integrity checks detect cracks, stopper defects, or particulate matter. These checks are often performed on samples from each batch. They help confirm that the drying cycle performed as intended.
A formulation often contains excipients that protect the active ingredient during freezing and drying. Bulking agents provide structure, while lyoprotectants stabilize sensitive molecules. The freezing step can produce ice crystals whose size and distribution affect the drying rate, and cycle design includes freezing, annealing, and drying phases. If the product temperature rises above a critical value, the cake may collapse or lose its porous structure. Successful lyophilization therefore depends on the interaction between formulation, equipment, and cycle design.
Lyophilization is a dehydration process that removes water from a frozen material by sublimation under low pressure. The material is first frozen to convert liquid water into ice. Next, the pressure is reduced below the triple point of water so that ice changes directly into vapor without passing through a liquid phase. This step is called primary drying. The result is a porous solid or cake that retains the original shape of the frozen solution.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white porous cake | Color and texture vary with formulation. |
| Reconstitution time | Seconds to several minutes | Depends on cake porosity, excipients, and diluent. |
| Typical moisture level | 0.5-3% w/w | Lower values suit hydrolysis-sensitive materials. |
| Common moisture method | Karl Fischer titration | Coulometric mode is common for low water levels. |
| Typical storage temperature | 2-8 °C or ambient | Some products require frozen storage; protect from humidity. |
Misconceptions about lyophilization include the idea that dried products are indefinitely stable or that vacuum sealing eliminates all degradation. Chemical reactions can continue in the solid state, and some proteins lose activity even at low moisture. Another misconception is that any freeze-dryer cycle can be scaled by time alone; heat and mass transfer differ with equipment and load. Open questions remain about predicting long-term stability from short accelerated studies, particularly for amorphous formulations. Real-time stability data remain the standard for shelf-life assignment.
After lyophilization, the dried product is often sealed under vacuum or an inert gas to limit moisture and oxygen exposure. Vials, stoppers, and seals must maintain their barrier throughout shelf life. Storage temperature depends on product sensitivity: some cakes tolerate controlled room temperature, while labile biologics require refrigeration. Humidity is a critical variable because dried cakes are hygroscopic and can absorb water when exposed to air. Handling procedures therefore limit open-vial time and use desiccated environments for sampling.
Freeze-drying is used for materials whose activity or structure depends on low temperature and low water content. Examples include certain biologics, diagnostic reagents, starter cultures, coffee, and porous inorganic precursors. The dried product forms a cake whose porosity aids rapid wetting and dissolution. Main drawbacks are high energy use, long cycle times, and sensitivity to formulation and equipment variation. Questions remain about how freezing rates and ice morphology affect batch uniformity, especially when moving from laboratory to production scale.
Lyophilization, also called freeze-drying, is a dehydration process in which a solvent, usually water, is frozen and then removed by sublimation under reduced pressure. The method preserves heat-sensitive materials that would degrade in conventional drying. Large-scale use grew during the mid-twentieth century for blood plasma and antibiotics, and it later expanded to vaccines, enzymes, foods, and advanced materials. The process produces a dry, porous solid that usually reconstitutes rapidly. It is distinct from simple evaporation because the solvent bypasses the liquid phase during primary removal.
The process generally proceeds in three stages: freezing, primary drying, and secondary drying. During freezing, controlled cooling converts water into ice and may also crystallize or vitrify solutes. In primary drying, the pressure is lowered below the triple point, and heat is supplied so ice sublimes directly to vapor. Secondary drying removes water that remains bound to the solid matrix, yielding a low final water content. Product temperature must stay below the collapse or glass transition temperature to maintain structure. Cycle design therefore balances shelf temperature, chamber pressure, and time.
Reconstitution involves adding a suitable diluent, often sterile water or a buffer, to the dried cake. Gentle swirling or inversion helps dissolve the material without creating excessive foam. The time required for complete dissolution can range from seconds to several minutes and depends on the cake structure and the diluent. Improper reconstitution, such as vigorous shaking or using the wrong diluent, can cause protein aggregation or loss of activity. After reconstitution, the product may have a limited shelf life and should be used according to its labeling.
Lyophilized products are typically hygroscopic and require protection from moisture during storage. Manufacturers seal them in glass vials, often under vacuum or an inert gas such as nitrogen. The container closure system, including the stopper and crimp seal, must prevent water vapor ingress. Storage temperature varies from controlled room temperature to refrigerated or frozen conditions, depending on the formulation. Humidity-controlled environments are essential because even brief exposure to ambient air can degrade the product.
Stability of a lyophilized product depends on its glass transition temperature, the temperature at which the amorphous cake transitions from a glassy to a rubbery state. Storage below this temperature minimizes molecular mobility and slows chemical degradation. If the storage temperature exceeds the glass transition temperature, the cake may collapse, shrink, or become sticky. Accelerated stability studies at elevated temperatures and humidity help predict shelf life, but they do not always reflect real-time behavior. Residual moisture content also plays a critical role in long-term stability.
The process usually has three stages: freezing, primary drying, and secondary drying. Freezing sets the ice crystal structure and can determine pore size in the final cake. Primary drying removes free ice by sublimation at low pressure and low shelf temperature. Secondary drying removes bound water by raising the shelf temperature, although some water may remain as part of the solid. Cycle parameters depend on formulation, fill volume, vial type, and equipment performance.
The physical chemistry of freezing influences whether a formulation forms an amorphous glass or a crystalline solid. Amorphous systems can collapse if product temperature rises above the glass transition temperature of the freeze concentrate. Crystalline systems may show eutectic melting, where ice and solute melt together at a fixed temperature. Formulators add bulking agents, lyoprotectants, and buffers to preserve structure and biological activity. The optimum cycle keeps product temperature below critical thresholds during primary drying while allowing efficient sublimation.
Lyophilization is a dehydration process that removes water from a frozen material by sublimation under low pressure. The material is first frozen so that water becomes ice; then the surrounding pressure is lowered below the vapor pressure of ice. Heat is applied gently so ice changes directly to vapor without passing through a bulk liquid phase. The vapor is collected on a cold condenser, leaving a dry porous matrix. This process differs from simple evaporation because the material remains frozen during the main drying stage.
Apical dominance occurs when the shoot apex inhibits the growth of lateral buds so that the plant may grow vertically. It is important for the plant to devote energy to growing upward so that it can get more light to undergo photosynthesis. If the plant utilizes available energy for growing upward, it may be able to outcompete other individuals in the vicinity. Plants that were capable of outcompeting neighboring plants likely had higher fitness. Apical dominance is therefore most likely adaptive. Typically, the end of a shoot contains an apical bud, which is the location where shoot growth occurs. The apical bud produces a plant hormone, auxin (IAA), that inhibits growth of the lateral buds further down on the stem towards the axillary bud. Auxin is predominantly produced in the growing shoot apex and is transported throughout the plant via the phloem and diffuses into lateral buds which prevents elongation. That auxin likely regulates apical dominance was first discovered in 1934. When the apical bud is removed, the lowered IAA concentration allows the lateral buds to grow and produce new shoots, which compete to become the lead growth.
Counter-Strike: Source is a tactical first-person shooter video game developed by Valve and Turtle Rock Studios. Released in October 2004 for Windows, it is a remake of Counter-Strike (2000) using the Source game engine. As in the original, Counter-Strike: Source pits a team of counter-terrorists against a team of terrorists in a series of rounds. Each round is won either by completing an objective (such as detonating a bomb or rescuing hostages) or by eliminating all members of the enemy team. The game was initially bundled with all retail and digital copies of Half-Life 2, before being released standalone.
=== Duration === Most cases of discontinuation syndrome may last between one and four weeks and resolve on their own. Occasionally symptoms can last up to one year. They typically resolve within a day of restoring the medication. Paroxetine and venlafaxine seem to be particularly difficult to discontinue, and prolonged withdrawal syndrome (post-acute-withdrawal syndrome, or PAWS) lasting over 18 months has been reported with paroxetine.
Unlike folinic acid, it may be used in MTFHR deficiency and MTHFS deficiency: 5-MTHF is the directly usable form of folate in methoinine metabolism, in contrast to folinic acid which needs to be converted to 5-MTHF by these enzymes. Secondary CFD could be treated by non-folate drugs, depending on the precise cause. For example, serine deficiency can be helped by direct supplementation of serine and glycine: this helps with seizure control but does little for psychomotor development. Folic acid (FA), the oxidized form commonly found in diet and ordinary supplements, is not suitable for most forms of CFD and may worsen it. "Transport of folate compounds from the intestine to the brain and competitive inhibition of 5-MTHF transport by FA. Conversion of FA to 5-MTHF is limited in the intestine and is mainly handled by DHFR in the liver, although its enzymatic activity is low in humans. In contrast, folinic acid is efficiently metabolized to 5-MTHF in the intestine and liver. When an excess amount of FA is taken, it cannot be fully reduced by DHFR in the liver and unmetabolized FA appears in the plasma. Because FA has higher affinity to FR1 expressed at the choroid plexus than 5-MTHF, it can act as a competitive inhibitor against 5-MTHF transport from the plasma to the CSF. In addition, FA cannot be metabolized to 5-MTHF efficiently in the brain with extremely low DHFR activity. Thus, excess FA intake may lead to a less effective supply of 5-MTHF to the brain compared with that of folinic acid supplementation."
== Structural studies == Several structures are available of this enzyme, which is part of the respiratory chain. It is a multi-subunit enzyme in which this activity is located in the hydrophilic domain. The subunits of the membrane-embedded domain are responsible for proton translocation.
Sources: en.wikipedia.org
=== Orthologs === The ortholog space of C3orf62 is fairly narrow, with the majority of orthologs found in mammals. A small fraction of orthologs have also been found in the following classes: Reptila, Sarcopterygii, and Actinoptergii. The groupings of nearly all Mammalia ortholog sequences of C3orf62 are as follows: E-value: 2e-94 to 1e-169; similarity 56-84%. Mammals in this group consist largely of primates but also include the following orders: Perissodactyla, Rodentia, Carnivora, Proboscidea, Cetartiodactyla, Cingulata, Artiodactyla, Eulipotyphla, Diselphimorphia, and Afrosoricida. More distantly related ortholog sequences of C3orf62 include organisms from classes Reptilia, Sarcopterygii, and Actinopterygii ranging from an E-value of 8e-10 to 3e-59 with similarity of 24-39%. Organisms in this grouping consist of Testudines, Coelacanthiformes, Squamata, and Osteoglossiformes orders. No ortholog sequences of C3orf62 were found for the following life forms: Bacteria, archaea, protist, plant, fungus, trichoplax, invertebrate, amphibian, or bird.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
=== Atmospheric contamination === Elevated radiation levels consistent with very low level atmospheric depleted uranium contamination have been found in air samples taken by the UK Atomic Weapons Establishment at several monitoring sites in Britain. These elevated readings appear to coincide with Operation Anaconda in Afghanistan, and the Shock and Awe bombing campaign at the start of the Second Gulf War.
Compulsive overeating, or emotional eating, is "the tendency to eat in response to negative emotions". Empirical studies have indicated that anxiety leads to decreased food consumption in people with normal weight and increased food consumption in the obese. Many laboratory studies showed that overweight individuals are more emotionally reactive and are more likely to overeat when distressed than people of normal weight. Furthermore, it was consistently found that obese individuals experience negative emotions more frequently and more intensively than do normal weight persons. The naturalistic study by Lowe and Fisher compared the emotional reactivity and emotional eating of normal and overweight female college students. The study confirmed the tendency of obese individuals to overeat, but these findings applied only to snacks, not to meals. That means that obese individuals did not tend to eat more while having meals; rather, the amount of snacks they ate between meals was greater. One possible explanation that Lowe and Fisher suggest is obese individuals often eat their meals with others and do not eat more than average due to the reduction of distress because of the presence of other people. Another possible explanation would be that obese individuals do not eat more than the others while having meals due to social desirability. Conversely, snacks are usually eaten alone.
Taha Othman Ishaq (or Osman), a lawyer and member of the FFC negotiating committee, declined his nomination by the FFC to the Sovereignty Council on the grounds that the FFC alliance had earlier agreed that members of the negotiating committee should not become members of the Sovereignty Council. Raja Nicola was the civilian member of the Sovereignty Council mutually chosen by the FFC and TMC. The choice of Nicola, as a member of the Sudanese Copt community, is seen as a symbol of respect for diversity, in particular to Sudanese Christians. On 4 February 2021, al-Burhan issued a decree to add three new members to the Council. The new members are Sudanese Revolutionary Front leader El Hadi Idris Yahya, Sudan People's Liberation Movement-North leader Malik Agar, and Sudan Liberation Movement for Justice-Karbino leader El Tahrir Abubakr Hajar.
Sources: en.wikipedia.org
== Metabolism and sources == Ergothioneine has been found in bacteria, plants, and animals, sometimes at high (millimolar) levels relative to the environment. Foods found to contain ergothioneine include liver, kidney, black beans, kidney bean, and oat bran, with the highest levels in bolete and oyster mushrooms, especially in Pleurotus citrinopileatus. Levels can be variable, even within species and some tissues can contain much more than others. In the human body, the largest amounts of ergothioneine are found in erythrocytes, eye lens, semen, and skin. Although many species contain ergothioneine, only a few make it; the others absorb it from their diet or, in the case of plants, from their environment. Biosynthesis has been detected in Actinomycetota, such as Mycobacterium smegmatis and certain fungi, such as Neurospora crassa (red bread mold) and Schizosaccharomyces pombe (fission yeast). Lactobacillus reuteri was reported to produce ergothioneine but later was clarified to merely accumulate rather than produce it. Other species of bacteria, such as Bacillus subtilis, Escherichia coli, Proteus vulgaris, and Streptococcus, as well as fungi in the Saccharomycotina cannot make ergothioneine.
EF-G has a complex evolutionary history, with numerous paralogous versions of the factor present in bacteria, suggesting subfunctionalization of different EF-G variants. Elongation factors exist in all three domains of life with similar function on the ribosome. The eukaryotic and archeal homologs of EF-G are eEF2 and aEF2, respectively. In bacteria (and some archaea), the fusA gene that encodes EF-G is found within the conserved str gene with the sequence 5′ - rpsL - rpsG - fusA - tufA - 3′. However, two other major forms of EF-G exist in some species of Spirochaetota, Planctomycetota, and δ-Proteobacteria (which has since been split and renamed Bdellovibrionota, Myxococcota, and Thermodesulfobacteriota), which form the spd group of bacteria that have elongation factors spdEFG1 and spdEFG2. From spdEFG1 and spdEFG2 evolved the mitochondrial elongation factors mtEFG1 (GFM1) and mtEFG2 (GFM2), respectively. The two roles of EF-G in elongation and termination of protein translation are split amongst the mitochondrial elongation factors, with mtEFG1 responsible for translocation and mtEFG2 responsible for termination and ribosomal recycling with mitochondrial RRF.
Within the known sequence, TAIL-PCR uses a nested pair of primers with differing annealing temperatures; a degenerate primer is used to amplify in the other direction from the unknown sequence. Touchdown PCR (Step-down PCR): a variant of PCR that aims to reduce nonspecific background by gradually lowering the annealing temperature as PCR cycling progresses. The annealing temperature at the initial cycles is usually a few degrees (3–5 °C) above the Tm of the primers used, while at the later cycles, it is a few degrees (3–5 °C) below the primer Tm. The higher temperatures give greater specificity for primer binding, and the lower temperatures permit more efficient amplification from the specific products formed during the initial cycles. Two-Tailed PCR is a technology developed by Professor Mikael Kubista to amplify short template molecules like microRNAs and even shorter using a hairpin primer that hybridizes to the target with both its 3' and 5'-ends. Universal Fast Walking: for genome walking and genetic fingerprinting using a more specific 'two-sided' PCR than conventional 'one-sided' approaches (using only one gene-specific primer and one general primer—which can lead to artefactual 'noise') by virtue of a mechanism involving lariat structure formation. Streamlined derivatives of UFW are LaNe RAGE (lariat-dependent nested PCR for rapid amplification of genomic DNA ends), 5'RACE LaNe and 3'RACE LaNe.
Cut flowers are flowers and flower buds (often with some stem and leaf) that have been cut from the plant bearing them. They are removed from the plant for decorative use. Cut greens are leaves with or without stems added to the cut flowers for contrast and design purposes. Floral design professionals work at florist shops (floristry) and use their design skills and experience with many types of flowers and greens to create works of art with flowers. Cut flowers, and to a lesser extent, cut greens, are a significant and international segment of the floral industry. The plants that are grown vary by plant species as well as by climate, cultural practices and the accessibility of worldwide transportation. Professional horticulturists raise the plants specifically for this purpose, in field or glasshouse growing conditions. Boxes of harvested flowers are shipped via air freight throughout the world. The study of the efficient production, distribution and marketing of floral crops is a branch of horticulture, called floriculture.
=== Limitations === As a standalone technique, RNP-MaP cannot be used to determine protein-RNA binding mechanisms or protein identities. In order to do so, RNP-MaP must be used in conjunction with other techniques such as CLIP and mass spectrometry. RNP-MaP requires extremely high read-depths for analysis. To identify RNP-MaP sites, 1000x sequencing coverage is required, while RNP-MaP correlation sites require 10,000x sequencing coverage. There are severe limitations on the ability to characterize RNP-MaP correlations between distant (>500 nucleotides) RNP-MaP sites. This is due to limitations of MaP reverse transcription processivity (500-600 nucleotides) and sequencing instrument clustering (<1,000 nucleotides).
Sources: en.wikipedia.org
Karl Fischer titration is a common method, using coulometric or volumetric detection. Thermogravimetric analysis can also measure weight loss on heating. Results depend on sample handling because the dried solid can absorb moisture quickly.
The porous cake readily absorbs water vapor from air, which can reduce stability or cause collapse. Vials are sealed with stoppers and crimp seals, sometimes under vacuum or inert gas. Packaging also protects against oxygen and mechanical damage.
Collapse occurs when the product temperature rises above its collapse threshold during primary drying. The ice matrix loses structure, and the cake may shrink or melt back. Formulation excipients and freezing rate influence collapse threshold.
Lyophilization removes water by sublimation from a frozen material, while evaporation changes liquid water into vapor. The low-pressure freezing step avoids the liquid phase and can preserve heat-sensitive structures.